ZNHIT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85673

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNHIT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673]

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673]

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673] - Staining of human fallopian tube shows moderate nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673]

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673]

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673]

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673]

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673] - Staining of human placenta shows strong positivity in trophoblastic cells.
ZNHIT1 Antibody - BSA Free Western Blot: ZNHIT1 Antibody - BSA Free [NBP1-85673]

Western Blot: ZNHIT1 Antibody - BSA Free [NBP1-85673]

Analysis in human cell line HEK 293.
ZNHIT1 Antibody - BSA Free Immunohistochemistry-Paraffin: ZNHIT1 Antibody - BSA Free [NBP1-85673]

Immunohistochemistry-Paraffin: ZNHIT1 Antibody - BSA Free [NBP1-85673]

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
ZNHIT1 Antibody - BSA Free Western Blot: ZNHIT1 Antibody - BSA Free [NBP1-85673]

Western Blot: ZNHIT1 Antibody - BSA Free [NBP1-85673]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
ZNHIT1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: ZNHIT1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: ZNHIT1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-ZNHIT1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
ZNHIT1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: ZNHIT1 Antibody [NBP1-85673]

Immunocytochemistry/ Immunofluorescence: ZNHIT1 Antibody [NBP1-85673]

Staining of human cell line A-431 shows localization to nucleoplasm.

Applications for ZNHIT1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNHIT1

Seems to play a role in p53-mediated apoptosis induction

Alternate Names

CG1I, CGBP1, Cyclin-G1-binding protein 1, H_DJ0747G18.14, p18 Hamlet, p18Hamlet, putative cyclin G1 interacting protein, zinc finger HIT domain-containing protein 1, Zinc finger protein subfamily 4A member 1, zinc finger protein, subfamily 4A (HIT domain containing), member 1, zinc finger, HIT domain containing 1, zinc finger, HIT type 1, zinc finger, HIT-type containing 1, ZNFN4A1

Gene Symbol

ZNHIT1

Additional ZNHIT1 Products

Product Documents for ZNHIT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNHIT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNHIT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNHIT1 Antibody - BSA Free and earn rewards!

Have you used ZNHIT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...