Kif4A Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-76115

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation, Chromatin Immunoprecipitation-exo-Seq

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all Kif4A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SITVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. As a result, each order represents a unique lot.

Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Free biotin from the conjugation process has been removed. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for Kif4A Antibody [Biotin]

Application
Recommended Usage

Chromatin Immunoprecipitation

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product

NBP2-56589

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Kif4A

The kinesin superfamily of proteins consists of over forty KIF motor proteins that function in intracellular transport along microtubules. Kinesin activity has been linked to various cellular functions such as vesicle transport, mitotic spindle formation, chromosome segregation, and cytokinesis. Structurally, all kinesins contain a motor domain with microtubule and nucleotide binding sites that utilize ATP to target cargo along microtubule filaments. KIF14 silencing experiments suggest that KIF14 plays a multi-functional role in mitosis and cytokinesis. KIF4A has been shown to be essential for cytokinesis. KIF4A is also known as kinesin family member 4A, chromosome-associated kinesin KIF4A, chromokinesin, KIF4, KIF4-G1, FLJ12530, FLJ12655, FLJ14204, FLJ20631, and HSA271784.

Alternate Names

chromokinesin-A, chromosome-associated kinesin KIF4A, FLJ12530, FLJ12655, FLJ14204, FLJ20631, HSA271784, KIF4G1, KIF4KIF4-G1, kinesin family member 4A

Gene Symbol

KIF4A

Additional Kif4A Products

Product Documents for Kif4A Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Kif4A Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kif4A Antibody [Biotin]

There are currently no reviews for this product. Be the first to review Kif4A Antibody [Biotin] and earn rewards!

Have you used Kif4A Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies