DIO2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84790

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DIO2. Peptide sequence: ILLKHVVLLLSRSKSTRGEWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DIO2 Antibody - BSA Free

Western Blot: DIO2 Antibody [NBP2-84790]

Western Blot: DIO2 Antibody [NBP2-84790]

Western Blot: DIO2 Antibody [NBP2-84790] - Host: Rabbit. Target Name: DIO2. Sample Tissue: ACHN Whole Cell lysates. Antibody Dilution: 1ug/ml
Western Blot: DIO2 Antibody [NBP2-84790]

Western Blot: DIO2 Antibody [NBP2-84790]

Western Blot: DIO2 Antibody [NBP2-84790] - Host: Rat. Target Name: DIO2. Sample Tissue: Rat Skeletal Muscle. Antibody Dilution: 1ug/ml

Applications for DIO2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DIO2

DIO2 is encoded by this gene belongs to the iodothyronine deiodinase family. It activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). It is highly expressed in the thyroid, and may contribute significantly to the relative increase in thyroidal T3 production in patients with Graves disease and thyroid adenomas. This protein contains selenocysteine (Sec) residues encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

5DII, D2, deiodinase, iodothyronine, type II, DIOII, EC 1.97.1, EC 1.97.1.10, ITDI2, SelY, TXDI2thyroxine deiodinase, type II, Type 2 DI, type 2 iodothyronine deiodinase, type II iodothyronine deiodinase, type-II 5'deiodinase, Type-II 5'-deiodinase

Gene Symbol

DIO2

Additional DIO2 Products

Product Documents for DIO2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DIO2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DIO2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DIO2 Antibody - BSA Free and earn rewards!

Have you used DIO2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...