FCER1G Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04822

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all FCER1G Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1). LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FCER1G Antibody - Azide and BSA Free

Western Blot: FCER1G AntibodyAzide and BSA Free [NBP3-04822]

Western Blot: FCER1G AntibodyAzide and BSA Free [NBP3-04822]

Western Blot: FCER1G Antibody [NBP3-04822] - Analysis of extracts of mouse spleen, using FCER1G antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Applications for FCER1G Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:1000-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: FCER1G

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha,1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. (provided by RefSeq)

Alternate Names

Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide, Fc-epsilon RI-gamma, FceRI gamma, FCRG, high affinity immunoglobulin epsilon receptor subunit gamma, IgE Fc receptor subunit gamma, immunoglobulin E receptor, high affinity, gamma chain

Gene Symbol

FCER1G

Additional FCER1G Products

Product Documents for FCER1G Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FCER1G Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for FCER1G Antibody - Azide and BSA Free

Customer Reviews for FCER1G Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FCER1G Antibody - Azide and BSA Free and earn rewards!

Have you used FCER1G Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies