HDC2/PHC2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03609

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 250-323 of human HDC2/PHC2 (NP_004418.2). HFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HDC2/PHC2 Antibody - Azide and BSA Free

Western Blot: HDC2/PHC2 AntibodyAzide and BSA Free [NBP3-03609]

Western Blot: HDC2/PHC2 AntibodyAzide and BSA Free [NBP3-03609]

Western Blot: HDC2/PHC2 Antibody [NBP3-03609] - Analysis of extracts of various cell lines, using HDC2/PHC2 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Applications for HDC2/PHC2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HDC2/PHC2

In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

early development regulator 2 (homolog of polyhomeotic 2), Early development regulatory protein 2, EDR2, hPH2, MGC163502, PH2, polyhomeotic 2, polyhomeotic homolog 2 (Drosophila), polyhomeotic-like 2, polyhomeotic-like 2 (Drosophila), polyhomeotic-like protein 2

Gene Symbol

PHC2

Additional HDC2/PHC2 Products

Product Documents for HDC2/PHC2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HDC2/PHC2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for HDC2/PHC2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HDC2/PHC2 Antibody - Azide and BSA Free and earn rewards!

Have you used HDC2/PHC2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...