AdTx1

Catalog #: 5940 Datasheet / COA / SDS

Discontinued Product

5940 has been discontinued.
View all Adrenergic alpha-1 Receptor Antagonists products.
AdTx1
1 Image
Description: Selective, high affinity, non-competitive α1A adrenoceptor antagonist
Alternative Names: ρ-Da1a
Product Details
Reviews

Biological Activity

Selective, high affinity, non-competitive α1A adrenoceptor antagonist (Ki = 0.35 nM). Exhibits no significant activity against a range of other GPCRs, including α2A, β1 and β2 adrenoceptors. Antagonizes effects of phenylephrine (Cat. No. 2838) on isolated rabbit prostate muscle in vitro and on intra-urethral pressure in rats.

Technical Data

M.Wt:
7283.22
Formula:
C310H481N87O100S8
Sequence:
LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE

(Modifications: Disulfide bridge: 3-24, 17-42, 46-57, 58-63)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for AdTx1

There are currently no reviews for this product. Be the first to review AdTx1 and earn rewards!

Have you used AdTx1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.