Recombinant Human Complement C4b GST (N-Term) Protein

Novus Biologicals | Catalog # H00000721-Q01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

Human C4B partial ORF ( NP_000583, 1347 a.a. - 1446 a.a.) recombinant protein with GST-tag at N-terminal.

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Complement C4b GST (N-Term) Protein

SDS-PAGE: Recombinant Human Complement C4b GST (N-Term) Protein [H00000721-Q01]

SDS-PAGE: Recombinant Human Complement C4b GST (N-Term) Protein [H00000721-Q01]

SDS-Page: Recombinant Human Complement C4b Protein [H00000721-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00000721-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Complement C4b

C4B - complement component 4B

Alternate Names

basic C4, Basic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3, C4B1, C4B12, C4B2, C4B3, C4FMGC164979, CH, Chido form of C4, CO4C4B5, complement C4-B, complement C4B1a, complement component 4B, complement component 4B (Chido blood group), CPAMD3FLJ60561, EC 2.1.1.144, EC 2.7.11

Gene Symbol

C4B

Additional Complement C4b Products

Product Documents for Recombinant Human Complement C4b GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Complement C4b GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Human Complement C4b GST (N-Term) Protein

Customer Reviews for Recombinant Human Complement C4b GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Complement C4b GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Complement C4b GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...