Thymosin β4

Catalog # Availability Size / Price Qty
3390/100U
Actin-related Products Peptide
1 Image
Description: Potent actin polymerization regulator
Product Details
Reviews

Biological Activity

Naturally occuring, potent regulator of actin polymerization present in human platelets at a concentration of 200 - 500 μM. Sequesters G-actin monomers in a 1:1 ratio (Kd = 0.7 - 1.0 μM) and allows rapid filament polymerization in the presence of profilin. Implicated in wound healing, induction of MMPs, chemotaxis, angiogenesis, inflammatory processes and tumor progression.

Technical Data

M.Wt:
4963.49
Formula:
C212H350N56O78S
Sequence:
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

(Modifications: Ser-1 = N-terminal Ac)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
77591-33-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Thymosin β10 and thymosin β4 are both actin monomer sequestering proteins.
    Yu et al.
    J.Biol.Chem., 1993;268:502
  2. β-thymosins, small acidic peptides with multiple functions.
    Huff et al.
    Int.J.Biochem.Cell Biol., 2001;33:205
  3. Thymosin β4 and angiogenesis: modes of action and therapeutic potential.
    Smart et al.
    Angiogenesis, 2007;10:229

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Thymosin β4

There are currently no reviews for this product. Be the first to review Thymosin β4 and earn rewards!

Have you used Thymosin β4?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.