Catalog Number: 5940
Alternate Names: ρ-Da1a
Biological Activity
Selective, high affinity, non-competitive α1A adrenoceptor antagonist (Ki = 0.35 nM). Exhibits no significant activity against a range of other GPCRs, including α2A, β1 and β2 adrenoceptors. Antagonizes effects of phenylephrine (Cat. No. 2838) on isolated rabbit prostate muscle in vitro and on intra-urethral pressure in rats.
Technical Data
  • M.Wt:
    7283.22
  • Formula:
    C310H481N87O100S8
  • Sequence:
    LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE

    (Modifications: Disulfide bridge: 3-24, 17-42, 46-57, 58-63)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Effects of ρ-Da1a a peptidic α1A-adrenoceptor antagonist in human isolated prostatic adenoma and anaesthetized rats.
    Palea et al.
    Br.J.Pharmacol., 2013;168:618
  2. Isolation and pharmacological characterization of AdTx1, a natural peptide displaying specific insurmountable antagonism of the α1A-adrenoceptor.
    Quinton et al.
    Br.J.Pharmacol., 2010;159:316

Have you used AdTx1?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

Feedback

Customer Information