CSAD Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-24766PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all CSAD Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CSAD

Source: E.coli

Amino Acid Sequence: KECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24766It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-24766PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CSAD

CSAD, also known as Cysteine sulfinic acid decarboxylase-related protein, consists of a 582 amino acid isoform that is 64 kDa, and is involved in the process through which cysteinesulfinate undergoes decarboxylation to produce hypotaurine. Current research is being conducted on CSAD to determine its relation to several diseases and disorders, including pulmonary edema, stiff-person syndrome, hepatocellular carcinoma, prostate cancer, seizures, and autoimmune diseases. CSAD interacts with SMN1, SMN2, ANXA1, ANXA7, and CDKN1A in several metabolic pathways and taurine biosynthesis.

Alternate Names

CSDMGC119355, cysteine sulfinic acid decarboxylase, Cysteine-sulfinate decarboxylase, EC 4.1.1, EC 4.1.1.29, FLJ44987, FLJ45500, MGC119354, MGC119357, PCAP, P-selectin cytoplasmic tail-associated protein, Sulfinoalanine decarboxylase

Gene Symbol

CSAD

Additional CSAD Products

Product Documents for CSAD Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CSAD Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for CSAD Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review CSAD Recombinant Protein Antigen and earn rewards!

Have you used CSAD Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes