DDX18 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-58939PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all DDX18 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX18.

Source: E. coli

Amino Acid Sequence: ETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58939.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-58939PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DDX18

DDX18, also known as ATP-dependent RNA helicase DDX18, is a 75.4 kDa 670 amino acid protein which is involved in unwinding RNA as a part of the DEAD box protein family. Current research is linking the protein to diseases and disorders such as malaria, arthritis, lung cancer, and neuroblastoma. The protein is involved in transcriptional activation pathways where it interacts with proteins such as HIST1H4A and HIST1H4B.

Alternate Names

DEAD (Asp-Glu-Ala-Asp) box polypeptide 18, DEAD box protein 18, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated), EC 3.6.1, EC 3.6.4.13, FLJ33908, MrDbATP-dependent RNA helicase DDX18, Myc-regulated DEAD box protein

Gene Symbol

DDX18

Additional DDX18 Products

Product Documents for DDX18 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDX18 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for DDX18 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review DDX18 Recombinant Protein Antigen and earn rewards!

Have you used DDX18 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes