GDF-9 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-49589PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all GDF-9 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GDF-9.

Source: E. coli

Amino Acid Sequence: YNINNSVSFSSAVKCVCNLMIKEPKSSSRTLGRAPYSFTFNSQFEFGKKHKWIQIDVTSLLQPLVASNKRSIHMSINFTCMKDQLEHP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49589.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-49589PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GDF-9

GDF9, also known as Growth/differentiation factor 9, is a 454 amino acid that is 51 kDa, is a multifunctional protein required for ovarian folliculogenesis; directly affects oocyte growth and function; stimulates granulosa cell proliferation; promotes primordial follicle development and cell transition from G0/G1 to S; regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells; increases the expression of inhibin B and suppresses FST and FSTL3 production in granulosa-lutein cells. Disease research is currently being studied with relation to GDF9 and polycystic ovary syndrome, premature ovarian failure, blepharophimosis, galactosemia, infertility, gonadal dysgenesis, twinning, prostate cancer, Huntington's disease, endometriosis, prostatitis, breast cancer, and hepatitis B. Interactions with GDF9 protein have been shown to involve SMN1, SMN2, APLP1, GADD45G, TK1, PRKRA and around 50 other interacting proteins in nuclear receptor activation by vitamin-A, paxillin interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts plus 44 more other pathways.

Long Name

Growth Differentiation Factor 9

Alternate Names

GDF9

Gene Symbol

GDF9

Additional GDF-9 Products

Product Documents for GDF-9 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GDF-9 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for GDF-9 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review GDF-9 Recombinant Protein Antigen and earn rewards!

Have you used GDF-9 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes