VPS45 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-81641PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all VPS45 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VPS45.

Source: E. coli

Amino Acid Sequence: LLNQWTYQAMVHELLGINNNRIDLSRVPGISKDLREVVLSAENDEFYANNMYLNFAEIGSNIKNLMEDFQKKKPKEQQKLESIADMKAFVENYPQFK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81641.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-81641PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: VPS45

FUNCTION: May play a role in vesicle-mediated protein trafficking from the Golgi stack through the trans-Golgi network. SUBUNIT: Interacts with STX6 and ZFYVE20. SUBCELLULAR LOCATION: Golgi apparatus membrane; Peripheral membrane protein. Endosome membrane; Peripheral membrane protein. Note: Associated with Golgi/endosomal vesicles and the trans-Golgi network. TISSUE SPECIFICITY: Ubiquitous; expression was highest in testis and in brain. Detected in every part of the brain.

Alternate Names

H1, H1VPS45, hlVps45, h-vps45, leucocyte vacuolar protein sorting 45, vacuolar protein sorting 45 homolog (S. cerevisiae), vacuolar protein sorting 45A, vacuolar protein sorting 45A (yeast homolog), vacuolar protein sorting 45A (yeast), vacuolar protein sorting-associated protein 45, VPS45A, VPS45AVPS54A, VPS45B, VSP45, VSP45A

Gene Symbol

VPS45

Additional VPS45 Products

Product Documents for VPS45 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VPS45 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for VPS45 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review VPS45 Recombinant Protein Antigen and earn rewards!

Have you used VPS45 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes