GRID2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35897

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GRID2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 900-1007 of human GRID2 (NP_001501.2).

Sequence:
IDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GRID2 Antibody - BSA Free

GRID2 Antibody

Immunocytochemistry/ Immunofluorescence: GRID2 Antibody [NBP3-35897] -

Immunocytochemistry/ Immunofluorescence: GRID2 Antibody [NBP3-35897] - Immunofluorescence analysis of L929 cells using GRID2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
GRID2 Antibody

Western Blot: GRID2 Antibody [NBP3-35897] -

Western Blot: GRID2 Antibody [NBP3-35897] - Western blot analysis of lysates from Mouse brian, using GRID2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
GRID2 Antibody

Immunocytochemistry/ Immunofluorescence: GRID2 Antibody [NBP3-35897] -

Immunocytochemistry/ Immunofluorescence: GRID2 Antibody [NBP3-35897] - Immunofluorescence analysis of C6 cells using GRID2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
GRID2 Antibody

Immunocytochemistry/ Immunofluorescence: GRID2 Antibody [NBP3-35897] -

Immunocytochemistry/ Immunofluorescence: GRID2 Antibody [NBP3-35897] - Immunofluorescence analysis of U-2 OS cells using GRID2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for GRID2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GRID2

Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamategated, cation-specific ion channels. Kainate/AMPA receptors co-localize with NMDA receptors in many synapses and consist of seven structurally related subunits, designated GluR-1 to -7, as well as GluR-delta2. The kainate/AMPA receptors are primarily responsible for the fast excitatory neurotransmission by glutamate whereas the NMDA receptors are functionally characterized by a slow kinetic and a high permeability for Ca2+ ions. The NMDA receptors consist of five subunits: episilon1, 2, 3, 4 and one zeta subunit. The zeta subunit is expressed throughout the brainstem whereas the four episilon subunits display limited distribution. In mice, mutations in the gene encoding GluR-delta2 (GRID2) cause the Lurcher phenotype. The gene encoding human GluR-delta2 maps to chromosome 4q22.

Long Name

Glutamate Receptor, Ionotropic, Delta 2

Alternate Names

GLURD2, GluRdelta2, Ms10ac, SCAR18

Gene Symbol

GRID2

Additional GRID2 Products

Product Documents for GRID2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GRID2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRID2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRID2 Antibody - BSA Free and earn rewards!

Have you used GRID2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies