ACTL7A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10626

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ACTL7A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse ACTL7A (NP_033741). Peptide sequence VVPIYEGYPLPSITGRLDYAGSDLTTYLMNLMNNSGKHFSEDHLGIVEDI

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ACTL7A Antibody - BSA Free

Western Blot: ACTL7A Antibody [NBP3-10626]

Western Blot: ACTL7A Antibody [NBP3-10626]

Western Blot: ACTL7A Antibody [NBP3-10626] - Western blot analysis of ACTL7A in Mouse Liver lysates. Antibody dilution at 1.0ug/ml

Applications for ACTL7A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACTL7A

ACTL7A is part of the actin-related proteins family, which are involved in a variety of cellular processes, nuclear functions and cytoskeleton activities. The exact function of ACTL7A is unknown but it has been shown to interact with TES, SOCS6 and ARPC3.

Alternate Names

actin-like 7A, actin-like 7-alpha, actin-like protein 7A, actin-like-7-alpha

Gene Symbol

ACTL7A

Additional ACTL7A Products

Product Documents for ACTL7A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACTL7A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACTL7A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACTL7A Antibody - BSA Free and earn rewards!

Have you used ACTL7A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies