ADAMTS18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57095

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ADAMTS18 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ADAMTS18(ADAM metallopeptidase with thrombospondin type 1 motif, 18) The peptide sequence was selected from the N terminal of ADAMTS18. Peptide sequence FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ADAMTS18 Antibody - BSA Free

Western Blot: ADAMTS18 Antibody [NBP1-57095]

Western Blot: ADAMTS18 Antibody [NBP1-57095]

Western Blot: ADAMTS18 Antibody [NBP1-57095] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for ADAMTS18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAMTS18

ADAMTS18 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein has a high sequence similarity to the protein encoded by gene ADAMTS16, another family member. It is thought to function as a tumor suppressor. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by gene ADAMTS16, another family member. It is thought to function as a tumor suppressor. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined.

Alternate Names

A disintegrin and metalloproteinase with thrombospondin motifs 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 21, ADAM metallopeptidase with thrombospondin type 1 motif, 18, ADAM-TS 18, ADAM-TS18, ADAMTS-18, ADAMTS21, disintegrin and metalloprotease-like protein, EC 3.4.24.-, EC 3.4.24.82

Gene Symbol

ADAMTS18

UniProt

Q8TE60 (Human)

Additional ADAMTS18 Products

Product Documents for ADAMTS18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADAMTS18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADAMTS18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAMTS18 Antibody - BSA Free and earn rewards!

Have you used ADAMTS18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies