AP1S2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87010

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all AP1S2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP1S2. Peptide sequence: YFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit AP1S2 Antibody - BSA Free (NBP2-87010) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for AP1S2 Antibody - BSA Free

Western Blot: AP1S2 Antibody [NBP2-87010]

Western Blot: AP1S2 Antibody [NBP2-87010]

Western Blot: AP1S2 Antibody [NBP2-87010] - Host: Rabbit. Target Name: AP1S2. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for AP1S2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AP1S2

Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where itmediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolictails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one smalladaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of theadaptin protein family. Transcript variants utilizing alternative polyadenylation signals exist for this gene.(provided by RefSeq)

Alternate Names

adaptor-related protein complex 1, sigma 2 subunit, MGC:1902, SIGMA1B, X-linked 59

Gene Symbol

AP1S2

Additional AP1S2 Products

Product Documents for AP1S2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AP1S2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AP1S2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AP1S2 Antibody - BSA Free and earn rewards!

Have you used AP1S2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies