AP3S1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55449

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AP3S1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275). Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AP3S1 Antibody - BSA Free

Western Blot: AP3S1 Antibody [NBP1-55449]

Western Blot: AP3S1 Antibody [NBP1-55449]

Western Blot: AP3S1 Antibody [NBP1-55449] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for AP3S1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AP3S1

AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Alternate Names

Adapter-related protein complex 3 sigma-1 subunit, adaptor-related protein complex 3, sigma 1 subunit, AP-3 complex sigma-3A subunit, AP-3 complex subunit sigma-3A, CLAPS3AP-3 complex subunit sigma-1, Clathrin-associated/assembly/adapter protein, small 3, clathrin-associated/assembly/adaptor protein, small 3 (22kD), Sigma3A, Sigma-3A-adaptin, Sigma3A-adaptin, Sigma-adaptin 3a

Gene Symbol

AP3S1

UniProt

Q92572 (Human)

Additional AP3S1 Products

Product Documents for AP3S1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AP3S1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for AP3S1 Antibody - BSA Free

Customer Reviews for AP3S1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AP3S1 Antibody - BSA Free and earn rewards!

Have you used AP3S1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies