ASB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82680

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ASB1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of ASB1. Peptide sequence: PGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKVDPEA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ASB1 Antibody - BSA Free

Western Blot: ASB1 Antibody [NBP2-82680]

Western Blot: ASB1 Antibody [NBP2-82680]

Western Blot: ASB1 Antibody [NBP2-82680] - WB Suggested Anti-ASB1 Antibody. Titration: 1.0 ug/ml. Positive Control: OVCAR-3 Whole Cell

Applications for ASB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASB1

ASB1 (ankyrin repeat and SOCS box-containing 1) protein is a 37 kD member of the ASB family. This protein is believed to be involved in protein stability by virtue of its SOCS box motif acting as an adaptor for SOCS box-containing proteins and/or their protein partners being targeted for proteasomal degradation. The Poly6149 antibody has been shown to be useful for Western blotting of the human and mouse ASB1 protein.

Alternate Names

ankyrin repeat and SOCS box containing 1, ankyrin repeat and SOCS box protein 1, ASB-1ankyrin repeat and SOCS box-containing 1, KIAA1146, MGC11165

Gene Symbol

ASB1

Additional ASB1 Products

Product Documents for ASB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ASB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASB1 Antibody - BSA Free and earn rewards!

Have you used ASB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies