AXUD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56324

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AXUD1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to AXUD1 (cysteine-serine-rich nuclear protein 1) The peptide sequence was selected from the middle region of AXUD1)(50ug). Peptide sequence ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AXUD1 Antibody - BSA Free

Western Blot: AXUD1 Antibody [NBP1-56324]

Western Blot: AXUD1 Antibody [NBP1-56324]

Western Blot: AXUD1 Antibody [NBP1-56324] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for AXUD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AXUD1

This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function.

Alternate Names

AXIN1 up-regulated 1, Axin-1 up-regulated gene 1 protein, AXUD1DKFZp566F164, CSRNP-1, cysteine/serine-rich nuclear protein 1, cysteine-serine-rich nuclear protein 1, FAM130B, Protein URAX1, TAIP3, TAIP-3TGF-beta-induced apoptosis protein 3, TGF-beta induced apoptosis protein 3, URAX1

Gene Symbol

CSRNP1

Additional AXUD1 Products

Product Documents for AXUD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AXUD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AXUD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AXUD1 Antibody - BSA Free and earn rewards!

Have you used AXUD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies