Calcyphosine Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58929

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Calcyphosine Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CAPS(calcyphosine) The peptide sequence was selected from the N terminal of CAPS. Peptide sequence DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Calcyphosine Antibody - BSA Free

Western Blot: Calcyphosine Antibody [NBP1-58929]

Western Blot: Calcyphosine Antibody [NBP1-58929]

Western Blot: Calcyphosine Antibody [NBP1-58929] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.
Western Blot: Calcyphosine Antibody [NBP1-58929]

Western Blot: Calcyphosine Antibody [NBP1-58929]

Western Blot: Calcyphosine Antibody [NBP1-58929] - Sample Type: Huh7 HepG2 (50ug) Primary Antibody Dilution:1:500 Image Submitted By: Partha Kasturi University of Kansas Medical Center.

Applications for Calcyphosine Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calcyphosine

CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.

Alternate Names

calcyphosin, Calcyphosine, calcyphosine 1, CAPS1, MGC126562, thyroid protein p24

Gene Symbol

CAPS

UniProt

Q13938 (Human)

Additional Calcyphosine Products

Product Documents for Calcyphosine Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Calcyphosine Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calcyphosine Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calcyphosine Antibody - BSA Free and earn rewards!

Have you used Calcyphosine Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies