CCBL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57482

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CCBL2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CCBL2(cysteine conjugate-beta lyase 2) The peptide sequence was selected from the C terminal of CCBL2. Peptide sequence LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CCBL2 Antibody - BSA Free

Western Blot: CCBL2 Antibody [NBP1-57482]

Western Blot: CCBL2 Antibody [NBP1-57482]

Western Blot: CCBL2 Antibody [NBP1-57482] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for CCBL2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCBL2

CCBL2 is an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. One of the transcripts encodes a predicted protein that has sequence identity to the protein encoded by the RNA binding motif protein, X-linked gene (RBMX).This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. One of the transcripts encodes a predicted protein that has sequence identity to the protein encoded by the RNA binding motif protein, X-linked gene (RBMX).

Alternate Names

cysteine conjugate-beta lyase 2, Cysteine-S-conjugate beta-lyase 2, DKFZp547N1117, EC 2.6.1.63, EC 2.6.1.7, EC 4.4.1.13, KAT3DKFZp667D0223, KATIII, Kynurenine aminotransferase III, Kynurenine--glyoxylate transaminase, kynurenine-oxoglutarate transaminase 3, kynurenine--oxoglutarate transaminase 3, Kynurenine--oxoglutarate transaminase III, MGC9398, RBM1, RP11-82K18.3, RP4-531M19.2

Gene Symbol

CCBL2

Additional CCBL2 Products

Product Documents for CCBL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CCBL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCBL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCBL2 Antibody - BSA Free and earn rewards!

Have you used CCBL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies