Cdc23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55022

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cdc23 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CDC23(cell division cycle 23 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of CDC23. Peptide sequence RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cdc23 Antibody - BSA Free

Western Blot: Cdc23 Antibody [NBP1-55022]

Western Blot: Cdc23 Antibody [NBP1-55022]

Western Blot: Cdc23 Antibody [NBP1-55022] - Jurkat cell lysate, concentration 1.25ug/ml.

Applications for Cdc23 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cdc23

CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.

Alternate Names

ANAPC8anaphase promoting complex subunit 8, Anaphase-promoting complex subunit 8, APC8CDC23 (cell division cycle 23, yeast, homolog), cell division cycle 23 homolog (S. cerevisiae), cell division cycle protein 23 homolog, CUT23, Cyclosome subunit 8

Gene Symbol

CDC23

UniProt

Q9UJX2 (Mouse)

Additional Cdc23 Products

Product Documents for Cdc23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cdc23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cdc23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cdc23 Antibody - BSA Free and earn rewards!

Have you used Cdc23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies