CEP57 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10779

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CEP57 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CEP57. Peptide sequence RLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPF

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CEP57 Antibody - BSA Free

Western Blot: CEP57 Antibody [NBP3-10779]

Western Blot: CEP57 Antibody [NBP3-10779]

Western Blot: CEP57 Antibody [NBP3-10779] - Western blot analysis of CEP57 in Fetal Liver lysates. Antibody dilution at 1.0ug/ml

Applications for CEP57 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CEP57

Translokin binds basic fibroblast growth factor (FGF2; MIM 134920) and mediates its nuclear translocation and mitogenic activity (Bossard et al., 2003 [PubMed 12717444]).[supplied by OMIM]

Alternate Names

centrosomal protein 57kDa, Cep57, FGF2-interacting protein, KIAA0092centrosomal protein of 57 kDa, PIG8, Testis-specific protein 57, Translokin, TSP57proliferation-inducing protein 8

Gene Symbol

CEP57

Additional CEP57 Products

Product Documents for CEP57 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CEP57 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CEP57 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CEP57 Antibody - BSA Free and earn rewards!

Have you used CEP57 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies