CEP72 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10639

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CEP72 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CEP72. Peptide sequence MSLTGLKSLDLSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHAL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CEP72 Antibody - BSA Free

Western Blot: CEP72 Antibody [NBP3-10639]

Western Blot: CEP72 Antibody [NBP3-10639]

Western Blot: CEP72 Antibody [NBP3-10639] - Western blot analysis of CEP72 in Human Thymus Tumor. Antibody dilution at 1 ug/mL

Applications for CEP72 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CEP72

CEP72 is a centrosomal protein that belongs to the leucine-rich-repeat (LRR) superfamily of proteins. The specific function of CEP72 has not been characterized.

Alternate Names

centrosomal protein 72kDa, centrosomal protein of 72 kDa, Cep72, KIAA1519FLJ10565, MGC5307

Gene Symbol

CEP72

Additional CEP72 Products

Product Documents for CEP72 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CEP72 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CEP72 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CEP72 Antibody - BSA Free and earn rewards!

Have you used CEP72 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies