cGAS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70755

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all cGAS Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to C6ORF150 The peptide sequence was selected from the middle region of C6ORF150. Peptide sequence VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for cGAS Antibody - BSA Free

Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755] - Fetal Liver lysates, Antibody Dilution: 0.2 ug/ml.
Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755]

Western Blot: cGAS Antibody [NBP1-70755] - Sample Type: Jurkat Whole Cell lysates Antibody Dilution: 0.2 ug/ml

Applications for cGAS Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: cGAS

The exact function of C6orf150 remains unknown.

Alternate Names

C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1

Gene Symbol

CGAS

Additional cGAS Products

Product Documents for cGAS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for cGAS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for cGAS Antibody - BSA Free

Customer Reviews for cGAS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review cGAS Antibody - BSA Free and earn rewards!

Have you used cGAS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies