Chondromodulin-1/LECT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59348

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Chondromodulin-1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to LECT1(leukocyte cell derived chemotaxin 1) The peptide sequence was selected from the N terminal of LECT1. Peptide sequence AIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Chondromodulin-1/LECT1 Antibody - BSA Free

Western Blot: Chondromodulin-1/LECT1 Antibody [NBP1-59348]

Western Blot: Chondromodulin-1/LECT1 Antibody [NBP1-59348]

Western Blot: Chondromodulin-1/LECT1 Antibody [NBP1-59348] - Sample Tissue: Human 786-0 Antibody Dilution: 1.0 ug/ml
Western Blot: Chondromodulin-1/LECT1 Antibody [NBP1-59348]

Western Blot: Chondromodulin-1/LECT1 Antibody [NBP1-59348]

Western Blot: Chondromodulin-1/LECT1 Antibody [NBP1-59348] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for Chondromodulin-1/LECT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Chondromodulin-1

LECT1 is a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The mature protein promotes chondrocyte growth and inhibits angiogenesis. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development.This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25 kDa mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This gene is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

BRICD3, ChM-1, Chondromodulin1, LECT1

Gene Symbol

CNMD

UniProt

O75829 (Human)

Additional Chondromodulin-1 Products

Product Documents for Chondromodulin-1/LECT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Chondromodulin-1/LECT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Chondromodulin-1/LECT1 Antibody - BSA Free

Customer Reviews for Chondromodulin-1/LECT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Chondromodulin-1/LECT1 Antibody - BSA Free and earn rewards!

Have you used Chondromodulin-1/LECT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies