CNNM4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92636

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all CNNM4 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 700-775 of human CNNM4 (NP_064569.3). VRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKASHENAI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CNNM4 Antibody - Azide and BSA Free

Western Blot: CNNM4 AntibodyAzide and BSA Free [NBP2-92636]

Western Blot: CNNM4 AntibodyAzide and BSA Free [NBP2-92636]

Western Blot: CNNM4 Antibody [NBP2-92636] - Analysis of extracts of various cell lines, using CNNM4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Applications for CNNM4 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CNNM4

Probable metal transporter. The interaction with the metal ion chaperone COX11 suggests that it may play a role in sensory neuron functions. May play a role in biomineralization and retinal function

Alternate Names

ACDP4cyclin-M4, Ancient conserved domain-containing protein 4, cyclin M4, Cyclin-M4, FLJ37746, FLJ42791, KIAA1592ancient conserved domain protein 4, metal transporter CNNM4

Gene Symbol

CNNM4

Additional CNNM4 Products

Product Documents for CNNM4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CNNM4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for CNNM4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CNNM4 Antibody - Azide and BSA Free and earn rewards!

Have you used CNNM4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies