COG1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87201

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all COG1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse COG1. Peptide sequence: ENQIKKEGAFPMTQNRALQLLYDLRYLTMVLSSKGEEVKSGRSKADSRME The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for COG1 Antibody - BSA Free

Western Blot: COG1 Antibody [NBP2-87201]

Western Blot: COG1 Antibody [NBP2-87201]

Western Blot: COG1 Antibody [NBP2-87201] - Host: Rabbit. Target Name: Cog1. Sample Type: Mouse Brain lysates. Antibody Dilution: 1.0ug/ml

Applications for COG1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COG1

COG1 is encoded by this gene is one of eight proteins (Cog1-8) which form a Golgi-localized complex (COG) required for normal Golgi morphology and function. It is thought that this protein is required for steps in the normal medial and trans Golgi-associated processing of glycoconjugates and plays a role in the organization of the Golgi-localized complex.

Alternate Names

COG complex subunit 1, component of oligomeric golgi complex 1CDG2G, conserved oligomeric Golgi complex subunit 1, KIAA1381DKFZp762L1710, LDLBconserved oligomeric Golgi complex protein 1, low density lipoprotein receptor defect B complementing

Gene Symbol

COG1

Additional COG1 Products

Product Documents for COG1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COG1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COG1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COG1 Antibody - BSA Free and earn rewards!

Have you used COG1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies