COPG Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57624

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all COPG Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to COPG (coatomer protein complex, subunit gamma) The peptide sequence was selected from the N terminal of COPG)(50ug). Peptide sequence MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for COPG Antibody - BSA Free

Western Blot: COPG Antibody [NBP1-57624]

Western Blot: COPG Antibody [NBP1-57624]

Western Blot: COPG Antibody [NBP1-57624] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Applications for COPG Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COPG

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.

Alternate Names

coat protein gamma-cop, coatomer protein complex, subunit gamma, coatomer protein complex, subunit gamma 1, COPG1coatomer subunit gamma, FLJ21068, Gamma-coat protein, Gamma-COP

Gene Symbol

COPG1

UniProt

Q9Y678 (Human)

Additional COPG Products

Product Documents for COPG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for COPG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COPG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COPG Antibody - BSA Free and earn rewards!

Have you used COPG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies