CRIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92498

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CRIP1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human CRIP1 (NP_001302.1). MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CRIP1 Antibody - BSA Free

CRIP1 Antibody - BSA Free

Western Blot: CRIP1 Antibody - BSA Free [NBP2-92498] -

Western Blot: CRIP1 Antibody - BSA Free [NBP2-92498] - Western blot analysis of various lysates using CRIP1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
CRIP1 Antibody - BSA Free

Western Blot: CRIP1 Antibody - BSA Free [NBP2-92498] -

Western Blot: CRIP1 Antibody - BSA Free [NBP2-92498] - Western blot analysis of various lysates using CRIP1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for CRIP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CRIP1

Alternate Names

CRHP, CRIPCRP1, CRP-1, Cysteine-rich heart protein, Cysteine-rich intestinal protein, cysteine-rich protein 1, cysteine-rich protein 1 (intestinal), FLJ40971, hCRHP

Gene Symbol

CRIP1

Additional CRIP1 Products

Product Documents for CRIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CRIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CRIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRIP1 Antibody - BSA Free and earn rewards!

Have you used CRIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies