DCC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56793

Novus Biologicals
Discontinued Product
NBP2-56793 has been discontinued. View all DCC products.

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DCC Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DCC Antibody [NBP2-56793]

Immunocytochemistry/ Immunofluorescence: DCC Antibody [NBP2-56793]

Immunocytochemistry/Immunofluorescence: DCC Antibody [NBP2-56793] - Staining of human cell line AF22 shows localization to the Golgi apparatus.

Applications for DCC Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DCC

Invasive, metastatic colon cancer arises from pre-existing adenomas in both familial and sporadic cases and is characterized by the presence of multiple chromosomal alterations. In the progression from intramucosal carcinoma to invasive carcinoma, allelic loss on the long arm of chromosome 18 is frequently observed. Recently, a gene on 18q21.3 termed DCC, for deleted in colorectal carcinoma, has been isolated and shown to be deleted or mutated in both sporadic and inherited colon carcinoma whereas normal colonic tissue retained and expressed the gene. Furthermore, loss of DCC expression appears to accompany progression of adenomas to metastatic carcinoma. The inactivation of DCC suggests that it is a tumor suppressor gene. A functional role for DCC as a tumor suppressor gene is indicated by experiments demonstrating that introduction of a normal chromosome 18 into the human colon tumor cell lines COKFu or SW480.7 lacking DCC suppresses tumorigenicity. Analysis of the amino acid sequence deduced from cDNA clones indicates that DCC is a transmembrane glycoprotein consisting of 1447 amino acids with an extracellular domain having extensive similarity to neural cell adhesion molecules (NCAM), a single transmembrane segment, and a unique cytoplasmic domain. The high degree of similarity to NCAMs suggests that DCC is involved in cell-cell interactions essential to the differentiated state of the colonic epithelium. DCC expression has been observed in all tissues examined except liver with the highest level of expression in brain tissue. Alterations in DCC expression have also been observed in pancreatic adenocarcinoma and esophogeal carcinoma. However, DCC mRNA is expressed at very low levels, requiring reverse transcription followed by PCR amplification for unambiguous detection.

Long Name

Deleted in Colorectal Cancer

Alternate Names

Colorectal cancer suppressor, CRC18, CRCR1, deleted in colorectal cancer protein, deleted in colorectal carcinoma, IGDCC1colorectal tumor suppressor, Immunoglobulin superfamily DCC subclass member 1, immunoglobulin superfamily, DCC subclass, member 1, netrin receptor DCC, Tumor suppressor protein DCC

Gene Symbol

DCC

Additional DCC Products

Product Documents for DCC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DCC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DCC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DCC Antibody - BSA Free and earn rewards!

Have you used DCC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...