DCTN5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84762

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DCTN5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat DCTN5. Peptide sequence: GELYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIIMNDCIIRGDLAN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DCTN5 Antibody - BSA Free

Western Blot: DCTN5 Antibody [NBP2-84762]

Western Blot: DCTN5 Antibody [NBP2-84762]

Western Blot: DCTN5 Antibody [NBP2-84762] - Host: Rabbit. Target Name: Dctn5. Sample Type: Rat Stomach lysates. Antibody Dilution: 1.0ug/ml

Applications for DCTN5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DCTN5

Dynactin (see MIM 601143) is a multimeric protein essential for minus-end-directed transport driven by themicrotubule-based motor dynein (see DYNC1H1; MIM 600112). DCTN5 is a subunit of the pointed-end subcomplex of dynactinthat is thought to interact with membranous cargo (Parisi et al., 2004 (PubMed 15043994)).(supplied by OMIM)

Alternate Names

dynactin 4, dynactin 5 (p25), dynactin subunit 5, Dynactin subunit p25, MGC3248, p25

Gene Symbol

DCTN5

Additional DCTN5 Products

Product Documents for DCTN5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DCTN5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DCTN5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DCTN5 Antibody - BSA Free and earn rewards!

Have you used DCTN5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies