DIS3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57189

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DIS3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DIS3(DIS3 mitotic control homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of DIS3. Peptide sequence DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DIS3 Antibody - BSA Free

Western Blot: DIS3 Antibody [NBP1-57189]

Western Blot: DIS3 Antibody [NBP1-57189]

Western Blot: DIS3 Antibody [NBP1-57189] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for DIS3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DIS3

DIS3, belonging to the ribonuclease II (RNB) family, has a 3'-5' exonuclease activity. It is a catalytic component of the exosome 3'->5' exoribonuclease complex required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay. The protein is implicated in mitotic control and essential for cell division and spore germination. It may be involved in regulating protein dephosphorylation during mitosis.

Alternate Names

2810028N01Rik, DIS3 mitotic control homolog (S. cerevisiae), dis3p, DKFZp667L1817, EC 3.1.13, EC 3.1.13.-, EC 3.1.26.-, EXOSC11, exosome complex exonuclease RRP44, exosome component 11, FLJ10484, KIAA1008RP11-342J4.3, MGC33035, mitotic control protein dis3 homolog, Protein DIS3 homolog, Ribosomal RNA-processing protein 44, RRP44bA555G22.1

Gene Symbol

DIS3

UniProt

Q9Y2L1 (Human)

Additional DIS3 Products

Product Documents for DIS3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DIS3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DIS3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DIS3 Antibody - BSA Free and earn rewards!

Have you used DIS3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies