DNA Polymerase epsilon p59 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84797

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DNA Polymerase epsilon p59 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DNA Polymerase epsilon p59. Peptide sequence: NINFFGGPSNTSVKTSAKLKQLEEENKDAMFVFLSDVWLDQVEVLEKLRI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DNA Polymerase epsilon p59 Antibody - BSA Free

Western Blot: DNA Polymerase epsilon p59 Antibody [NBP2-84797]

Western Blot: DNA Polymerase epsilon p59 Antibody [NBP2-84797]

Western Blot: DNA Polymerase epsilon p59 Antibody [NBP2-84797] - Host: Rabbit. Target Name: POLE2. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for DNA Polymerase epsilon p59 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNA Polymerase epsilon p59

Participates in DNA repair and in chromosomal DNA replication

Alternate Names

DNA polymerase epsilon subunit 2, DNA polymerase II subunit 2, DPE2DNA polymerase epsilon subunit B, EC 2.7.7.7, polymerase (DNA directed), epsilon 2 (p59 subunit)

Gene Symbol

POLE2

Additional DNA Polymerase epsilon p59 Products

Product Documents for DNA Polymerase epsilon p59 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNA Polymerase epsilon p59 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNA Polymerase epsilon p59 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNA Polymerase epsilon p59 Antibody - BSA Free and earn rewards!

Have you used DNA Polymerase epsilon p59 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies