DNAJB7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84801

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DNAJB7 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of DNAJB7. Peptide sequence: AEDNGELTFFLVNSVANEEGFAKECSWRTQSFNNYSPNSHSSKHVSQYTF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DNAJB7 Antibody - BSA Free

Western Blot: DNAJB7 Antibody [NBP2-84801]

Western Blot: DNAJB7 Antibody [NBP2-84801]

Western Blot: DNAJB7 Antibody [NBP2-84801] - WB Suggested Anti-DNAJB7 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Bladder

Applications for DNAJB7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJB7

DNAJB7 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM]

Alternate Names

DnaJ (Hsp40) homolog, subfamily B, member 7, dnaJ homolog subfamily B member 7, HSC3DJ5, MGC138340, novel DnaJ domain protein

Gene Symbol

DNAJB7

Additional DNAJB7 Products

Product Documents for DNAJB7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNAJB7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJB7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJB7 Antibody - BSA Free and earn rewards!

Have you used DNAJB7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies