DNASE1L3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84008

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DNASE1L3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal DNASE1L3. Peptide sequence: DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DNASE1L3 Antibody - BSA Free

Western Blot: DNASE1L3 Antibody [NBP2-84008]

Western Blot: DNASE1L3 Antibody [NBP2-84008]

Western Blot: DNASE1L3 Antibody [NBP2-84008] - Host: Rabbit. Target Name: DNASE1L3. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: DNASE1L3 Antibody [NBP2-84008]

Western Blot: DNASE1L3 Antibody [NBP2-84008]

Western Blot: DNASE1L3 Antibody [NBP2-84008] - WB Suggested Anti-DNASE1L3 Antibody. Titration: 1.0 ug/ml. Positive Control: Placenta
Western Blot: DNASE1L3 Antibody [NBP2-84008]

Western Blot: DNASE1L3 Antibody [NBP2-84008]

Western Blot: DNASE1L3 Antibody [NBP2-84008] - Host: Rabbit. Target: DNASE1L3. Positive control (+): Human liver (LI). Negative control (-): Human lung (LU). Antibody concentration: 3ug/ml

Applications for DNASE1L3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNASE1L3

The DNASE1L3 gene encodes a member of the DNase family. The protein hydrolyzes DNA, is not inhibited by actin, and mediates thebreakdown of DNA during apoptosis. Alternate transcriptional splice variants of this gene have been observed but havenot been thoroughly

Alternate Names

deoxyribonuclease gamma, deoxyribonuclease I-like 3Liver and spleen DNase, deoxyribonuclease I-like III, DNAS1L3LSDDHP2, DNase gamma, DNase I homolog protein 2, DNase I homolog protein DHP2, DNase I-like 3, EC 3.1.21.-, EC 3.1.21.1, LS-DNase

Gene Symbol

DNASE1L3

Additional DNASE1L3 Products

Product Documents for DNASE1L3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNASE1L3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNASE1L3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNASE1L3 Antibody - BSA Free and earn rewards!

Have you used DNASE1L3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies