DNASE2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10550

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DNASE2B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DNASE2B (NP_490649). Peptide sequence QKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DNASE2B Antibody - BSA Free

Western Blot: DNASE2B Antibody [NBP3-10550]

Western Blot: DNASE2B Antibody [NBP3-10550]

Western Blot: DNASE2B Antibody [NBP3-10550] - Western blot analysis using NBP3-10550 on Human 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for DNASE2B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNASE2B

DNASE2B, also known as Deoxyribonuclease-2-beta, consists of a 41.7 kDa and a 17.8 kDa isoform and is utilized in the eye lens, salivary glands, and lungs to hydrolyze DNA in acidic conditions. Diseases and disorder such as cataract, prostatitis, and alcoholism have been researched with the protein. The protein interacts in lysosome pathways with RBL1.

Alternate Names

deoxyribonuclease II betaDNase2-like acid DNase, DLADdeoxyribonuclease-2-beta, DNase II beta, DNase II-like acid DNase, EC 3.1.22.1, Endonuclease DLAD, lysosomal DNase II

Gene Symbol

DNASE2B

Additional DNASE2B Products

Product Documents for DNASE2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNASE2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNASE2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNASE2B Antibody - BSA Free and earn rewards!

Have you used DNASE2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies