Epsin 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84862

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Epsin 3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Epsin 3. Peptide sequence: ESTETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGIL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Epsin 3 Antibody - BSA Free

Western Blot: Epsin 3 Antibody [NBP2-84862]

Western Blot: Epsin 3 Antibody [NBP2-84862]

Western Blot: Epsin 3 Antibody [NBP2-84862] - Host: Rabbit. Target Name: EPN3. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Epsin 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Epsin 3

The EPSN3 gene encodes an epsin-3 protein that in isoform 1 is 632 amino acids long at 68 kDA and in isoform 2 is 208 amino acids long at 23 kDA. EPSN3 participates in endocytosis, germ cell-sertoli cell junction dynamics, and endocytic trafficking of EGFR through interactions with genes EGFR, ERBB4, CSF1R, and LAPTM5. EPSN3 has been linked to basal cell carcinoma and ulcerative colitis.

Alternate Names

EPS-15-interacting protein 3, epsin 3, epsin-3, FLJ20778, MGC129899

Gene Symbol

EPN3

Additional Epsin 3 Products

Product Documents for Epsin 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Epsin 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Epsin 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Epsin 3 Antibody - BSA Free and earn rewards!

Have you used Epsin 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies