Exosome Component 9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87379

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Exosome Component 9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Exosome Component 9. Peptide sequence: ERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Exosome Component 9 Antibody - BSA Free

Western Blot: Exosome Component 9 Antibody [NBP2-87379]

Western Blot: Exosome Component 9 Antibody [NBP2-87379]

Western Blot: Exosome Component 9 Antibody [NBP2-87379] - WB Suggested Anti-EXOSC9 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Heart

Applications for Exosome Component 9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Exosome Component 9

Exosome Component 9 is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. Required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA. H

Alternate Names

p5, p6, PCH1D, PM/Scl-75, PMSCL1, RRP45, Rrp45p

Gene Symbol

EXOSC9

Additional Exosome Component 9 Products

Product Documents for Exosome Component 9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Exosome Component 9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Exosome Component 9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Exosome Component 9 Antibody - BSA Free and earn rewards!

Have you used Exosome Component 9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies