FAAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56856

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FAAP Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to C22ORF28 The peptide sequence was selected from the middle region of C22ORF28. Peptide sequence EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FAAP Antibody - BSA Free

Western Blot: FAAP Antibody [NBP1-56856]

Western Blot: FAAP Antibody [NBP1-56856]

Western Blot: FAAP Antibody [NBP1-56856] - Human Hela, Antibody Dilution: 1.0 ug/ml RTCB is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: FAAP Antibody [NBP1-56856]

Western Blot: FAAP Antibody [NBP1-56856]

Western Blot: FAAP Antibody [NBP1-56856] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: FAAP Antibody [NBP1-56856]

Western Blot: FAAP Antibody [NBP1-56856]

Western Blot: FAAP Antibody [NBP1-56856] - Human 721_B, Antibody Dilution: 1.0 ug/ml RTCB is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: FAAP Antibody [NBP1-56856]

Western Blot: FAAP Antibody [NBP1-56856]

Western Blot: FAAP Antibody [NBP1-56856] - Human Jurkat, Antibody Dilution: 1.0 ug/ml RTCB is supported by BioGPS gene expression data to be expressed in Jurkat.

Applications for FAAP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAAP

The function of this protein remains unknown.

Alternate Names

ankyrin repeat domain 54, C22orf28, chromosome 22 open reading frame 28, DJ149A16.6, EC 6.5.1.3, HSPC117, hypothetical protein LOC51493, novel protein HSPC117, RP1-149A16.6

Gene Symbol

RTCB

UniProt

Q9Y3I0 (Human)

Additional FAAP Products

Product Documents for FAAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FAAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FAAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAAP Antibody - BSA Free and earn rewards!

Have you used FAAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies