FADS3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87389

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FADS3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat FADS3. Peptide sequence: DISRWAQRHPGGSRLIGHHSAEDATDAFHAFHQDLHFVRKFLKPLLIGEL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FADS3 Antibody - BSA Free

Western Blot: FADS3 Antibody [NBP2-87389]

Western Blot: FADS3 Antibody [NBP2-87389]

Western Blot: FADS3 Antibody [NBP2-87389] - Host: Rabbit. Target Name: Fads3. Sample Type: Rat Kidney lysates. Antibody Dilution: 1.0ug/ml

Applications for FADS3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FADS3

The FADS3 gene encodes a 445 amino acid long, 51 kDA fatty acid desaturase 3 protein that, through the introduction of double bonds between carbons of the fatty acids, regulate unsaturation of fatty acids. FADS3 is associated with familial combined hyperlipidemia and coronary heart disease. FADS3 interacts with the UBC gene.

Alternate Names

CYB5RPlinoleoyl-CoA desaturase (delta-9-desaturase)-like 3, Cytochrome b5-related protein, delta-9 fatty acid desaturase, delta-9-desaturase, EC 1.14.19, EC 1.14.19.-, fatty acid desaturase 3, LLCDL3

Gene Symbol

FADS3

Additional FADS3 Products

Product Documents for FADS3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FADS3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FADS3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FADS3 Antibody - BSA Free and earn rewards!

Have you used FADS3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies