FVT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10588

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FVT1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human FVT1 (NP_002026.1). Peptide sequence KKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FVT1 Antibody - BSA Free

Western Blot: FVT1 Antibody [NBP3-10588]

Western Blot: FVT1 Antibody [NBP3-10588]

Western Blot: FVT1 Antibody [NBP3-10588] - Western blot analysis of FVT1 in PANC1 Whole cell lysates. Antibody dilution at 1.0ug/ml

Applications for FVT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FVT1

The protein encoded by the FVT1 gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy.

Alternate Names

3-ketodihydrosphingosine reductase, DHSR, EC 1.1.1.102,3-dehydrosphinganine reductase, FLJ36555, FLJ92680, follicular lymphoma variant translocation 1, Follicular variant translocation protein 1, FVT-1, FVT1KDS reductase, SDR35C1, short chain dehydrogenase/reductase family 35C, member 1

Gene Symbol

KDSR

Additional FVT1 Products

Product Documents for FVT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FVT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FVT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FVT1 Antibody - BSA Free and earn rewards!

Have you used FVT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies