GARS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54602

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GARS Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GARS(glycyl-tRNA synthetase) The peptide sequence was selected from the middle region of GARS. Peptide sequence IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GARS Antibody - BSA Free

Western Blot: GARS Antibody [NBP1-54602]

Western Blot: GARS Antibody [NBP1-54602]

Western Blot: GARS Antibody [NBP1-54602] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for GARS Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GARS

GARS catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

AP-4-A synthetase, Charcot-Marie-Tooth neuropathy 2D, Charcot-Marie-Tooth neuropathy, neuronal type, D, Diadenosine tetraphosphate synthetase, DSMAV, glycine tRNA ligase, Glycine--tRNA ligase, glycyl-tRNA synthetase, GlyRSEC 6.1.1.14, HMN5, SMAD1CMT2D

Gene Symbol

GARS1

UniProt

P41250 (Human)

Additional GARS Products

Product Documents for GARS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GARS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GARS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GARS Antibody - BSA Free and earn rewards!

Have you used GARS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies