GDAP1L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84965

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GDAP1L1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat GDAP1L1. Peptide sequence: FLGLSKKYWEDGSRPNLQSFFERVQRRLAFRKVLGDIHTTLLSAVIPNAF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GDAP1L1 Antibody - BSA Free

Western Blot: GDAP1L1 Antibody [NBP2-84965]

Western Blot: GDAP1L1 Antibody [NBP2-84965]

Western Blot: GDAP1L1 Antibody [NBP2-84965] - Host: Rabbit. Target Name: Gdap1l1. Sample Type: Rat Kidney lysates. Antibody Dilution: 1.0ug/ml

Applications for GDAP1L1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GDAP1L1

The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. The protein encoded by this gene is similar in sequence to the human GDAP1 protein. [provided by RefSeq]

Alternate Names

dJ881L22.1, dJ995J12.1.1, DKFZp761K228, ganglioside-induced differentiation-associated protein 1-like 1, GDAP1-L1

Gene Symbol

GDAP1L1

Additional GDAP1L1 Products

Product Documents for GDAP1L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GDAP1L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GDAP1L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GDAP1L1 Antibody - BSA Free and earn rewards!

Have you used GDAP1L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies