GLP-1 (7-37)

Catalog # Availability Size / Price Qty
5374/1
GLP-1 (7-37)
1 Image
Description: Endogenous bioactive GLP-1 receptor ligand

Purity: ≥95%

Product Details
Supplemental Products
Reviews

Biological Activity

GLP-1 (7-37) is a endogenous GLP-1 receptor ligand; bioactive and truncated form of GLP-1; insulinotropic hormone.

Technical Data

M.Wt:
3355.71
Formula:
C151H228N40O47
Sequence:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
106612-94-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for GLP-1 (7-37)

There are currently no reviews for this product. Be the first to review GLP-1 (7-37) and earn rewards!

Have you used GLP-1 (7-37)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.