Glucagon-like peptide 1 (7-36) amide (human, rat) (CAS 107444-51-9): R&D Systems
Catalog Number: 2082
Alternate Names: GLP-1 (7-36) amide
Biological Activity
Potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells. Displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.
Technical Data
  • M.Wt:
    3297.67
  • Formula:
    C149H226N40O45
  • Sequence:
    HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

    (Modifications: Arg-30 = C-terminal amide)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    107444-51-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Protection and reversal of excitotoxic neuronal damage by glucagon-like peptide-1 and exendin-4.
    Perry et al.
    J.Pharmacol.Exp.Ther., 2002;302:881
  2. Receptors for glucagon-like peptide-1(7-37) amide on rat insulinoma-derived cells.
    Goke and Conlon
    J.Endocrinol., 1988;116:357
  3. A role for glucagon-like peptide-1 in the central regulation of feeding.
    Turton et al.
    Nature, 1996;379:69
  4. Glucagon-like peptide-1: a major regulator of pancreatic β-cell function.
    Perfetti and Merkel
    Eur.J.Endocrinol., 2000;143:717
Tocris Peptides
Description Application Cat# Citations Images  

GLP-1 (9-36) amide

3266  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Have you used Glucagon-like peptide 1 (7-36) amide (human, rat)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information