Glucagon-like peptide 1 (7-36) amide (human, rat)

Catalog # Availability Size / Price Qty
2082/1
Glucagon-like peptide 1 (7-36) amide (human, rat)
1 Image
Description: Potent insulinotropic peptide
Alternative Names: GLP-1 (7-36) amide
Product Details
Supplemental Products
Reviews

Biological Activity

Potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells. Displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.

Technical Data

M.Wt:
3297.67
Formula:
C149H226N40O45
Sequence:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

(Modifications: Arg-30 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
107444-51-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Tocris Peptides

VersaClone cDNA Plasmids

Reviews for Glucagon-like peptide 1 (7-36) amide (human, rat)

There are currently no reviews for this product. Be the first to review Glucagon-like peptide 1 (7-36) amide (human, rat) and earn rewards!

Have you used Glucagon-like peptide 1 (7-36) amide (human, rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.