GLUT10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59688

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GLUT10 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC2A10(solute carrier family 2 (facilitated glucose transporter), member 10) The peptide sequence was selected from the middle region of SLC2A10. Peptide sequence AKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GLUT10 Antibody - BSA Free

Western Blot: GLUT10 Antibody [NBP1-59688]

Western Blot: GLUT10 Antibody [NBP1-59688]

Western Blot: GLUT10 Antibody [NBP1-59688] - Jurkat cell lysate, concentration 2.5 ug/ml.

Applications for GLUT10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GLUT10

SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis.SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis.[supplied by OMIM].

Alternate Names

ATS, Glucose transporter type 10, GLUT-10, GLUT10MGC126706, solute carrier family 2 (facilitated glucose transporter), member 10, solute carrier family 2, facilitated glucose transporter member 10

Gene Symbol

SLC2A10

UniProt

O95528 (Human)

Additional GLUT10 Products

Product Documents for GLUT10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GLUT10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GLUT10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GLUT10 Antibody - BSA Free and earn rewards!

Have you used GLUT10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies