Glycerol 3 Phosphate Dehydrogenase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55332

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glycerol 3 Phosphate Dehydrogenase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GPD1(glycerol-3-phosphate dehydrogenase 1 (soluble)) The peptide sequence was selected from the middle region of GPD1. Peptide sequence TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Glycerol 3 Phosphate Dehydrogenase Antibody - BSA Free

Western Blot: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-55332]

Western Blot: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-55332]

Western Blot: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-55332] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Applications for Glycerol 3 Phosphate Dehydrogenase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glycerol 3 Phosphate Dehydrogenase

GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Alternate Names

EC 1.1.1, EC 1.1.1.8, FLJ26652, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic, glycerol-3-phosphate dehydrogenase 1 (soluble), glycerol-3-phosphate dehydrogenase, soluble, GPD-C, GPDH-C

Gene Symbol

GPD1

UniProt

P21695 (Human)

Additional Glycerol 3 Phosphate Dehydrogenase Products

Product Documents for Glycerol 3 Phosphate Dehydrogenase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glycerol 3 Phosphate Dehydrogenase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glycerol 3 Phosphate Dehydrogenase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glycerol 3 Phosphate Dehydrogenase Antibody - BSA Free and earn rewards!

Have you used Glycerol 3 Phosphate Dehydrogenase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies