GTP binding protein era homolog Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57493

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GTP binding protein era homolog Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ERAL1(Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the middle region of ERAL1. Peptide sequence KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GTP binding protein era homolog Antibody - BSA Free

Western Blot: GTP binding protein era homolog Antibody [NBP1-57493]

Western Blot: GTP binding protein era homolog Antibody [NBP1-57493]

Western Blot: GTP binding protein era homolog Antibody [NBP1-57493] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for GTP binding protein era homolog Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTP binding protein era homolog

ERAL1 belongs to the era/mnmE GTP-binding protein family.

Alternate Names

CEGA, Conserved ERA-like GTPase, ERA, Era (E. coli G-protein homolog)-like 1, Era G-protein-like 1 (E. coli), ERAL1A, ERA-like protein 1, ERA-W, GTPase Era, mitochondrial, GTPase, human homolog of E. coli essential cell cycle protein Era, GTP-binding protein era homolog, hERA, H-ERA, HERA-A, HERA-B

Gene Symbol

ERAL1

UniProt

O75616 (Human)

Additional GTP binding protein era homolog Products

Product Documents for GTP binding protein era homolog Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GTP binding protein era homolog Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTP binding protein era homolog Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTP binding protein era homolog Antibody - BSA Free and earn rewards!

Have you used GTP binding protein era homolog Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies